DPCstruct | MC6973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 92 ± 15 aa |
| Standard deviation of domain lengths | 14.97 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453I8P2 | 62-142 | MAYFAISLVNVLTDLLESKQENIHILGCQTLARFIYSQVDNTYARNIESLVHKVCTLSRQQGVEHSLLRAASLQCLSAMIW |
| A0A2G3A6R2 | 1-95 | MVVELLDDSKTDAIRITGCQMLTKFIYSQVDGTHSYNVETLVPKVCSLARETGEEREKRSLRASSLQCLSAMASICRRRDHICWPMV… |
| A0A445AVG1 | 96-179 | None |
| A0A7J0F332 | 110-210 | None |
| A2XQ50 | 95-190 | None |
| A0A6P5MZJ3 | 9-92 | None |
| A0A445IMJ6 | 110-191 | None |
| A0A540K4S8 | 3-80 | None |
| A0A444E9Y4 | 15-96 | None |
| A0A1D6MMU5 | 44-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.