DPCstruct | MC6972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 8.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 60.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0539 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9QEJ6 | 96-170 | ASADAVSRRIAEVSGVDACATAGARLGLEKIVRVSTGTDSSSPAVICAAFRAIFGAVAVDSGNVDSAGDVFWKVH |
| A0A2G3A1R2 | 1-87 | MPPKDLNRVIVDLSSNVVSSCVADGGRLGLQKIIRVSRKTNSSAPAVVCGAFRAVFGAIAIDKSSLDSAGKVFLTIHGKGMEKAMAI |
| A0A1R3JFA6 | 16-100 | None |
| A0A7J0GAF6 | 55-154 | None |
| A0A438EYL6 | 23-121 | None |
| M1C9S7 | 1-77 | None |
| A0A2G2V9Z2 | 56-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.