DPCstruct | MC6970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 90 ± 4 aa |
| Standard deviation of domain lengths | 3.62 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 68.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5VHM3 | 1-94 | MKLQTEIFFASIDQRSERAAGESACTALVAVIADWFQNNRELMPIKSQFDSLIREGSLEWRNLCENETYRERFPDKHFDLETVLQAK… |
| A0A2G2ZT27 | 1-91 | MKLQTQIFFASIDQRSERASGESACTTLVAVIADWFHCNPEDMPIKSQLDSLICEGSMQWRDLSENETYRERFPDKHFDLETVLEAK… |
| A9S632 | 99-185 | None |
| A0A834ZB77 | 445-531 | None |
| A0A1R3QZ56 | 255-348 | None |
| A0A0K9QQX4 | 309-393 | None |
| A0A287Q9M7 | 207-293 | None |
| A0A7J0EEJ7 | 82-173 | None |
| A0A7N0T9J9 | 7-103 | None |
| A0A7I8IBV2 | 159-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.