DPCstruct | MC697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 208 ± 17 aa |
| Standard deviation of domain lengths | 17.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R0LEY7 | 5-210 | KDRKHHKARMDQRTRERPPLLPVLSDTVDRRRRAAAELLAAAGHTRPGDLIPDTAGTLRRAVAPKATGHLTWVEETSTGRRRNLTYE… |
| A0A5C4IMM9 | 18-217 | TVPAFLSSAEDLKEKGNRLLERTWPPPISETYTVDGVTYRRHDPPVHKKSNTRARIWAEVVDAETGSRPPVPVGKRADVTSVEADSF… |
| X7XQ72 | 145-377 | None |
| A0A511MM73 | 61-258 | None |
| A0A2A2Z679 | 241-418 | None |
| A0A2S9PV70 | 128-319 | None |
| A0A260TD63 | 402-638 | None |
| W7SJK1 | 192-415 | None |
| A0A7W8B4Y7 | 821-1011 | None |
| A0A0A8EU80 | 131-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.