DPCstruct | MC6966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 5.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2C5L3 | 304-403 | AMDFIWYMWCGPDAPLFDKNKMATFERYFIADKELHKEKKGHYYTLRNQEDICNKILDEFGASGPHSHIINGHVPVKTIKGEQPIKA… |
| A0A7V8M7S1 | 1-104 | MWYLWTGPNSPLFGKHDMTTFERYFISDPKAHVEGRNPYYHLRKDPEFIKKILAEFVLDPEVGHVINGHTPVKKGTDPIMANNKMIV… |
| A0A854XE81 | 82-185 | None |
| A0A1V5VT59 | 2-97 | None |
| A0A7E4S0E4 | 250-354 | None |
| Q7P7U2 | 140-244 | None |
| T0CYQ5 | 253-338 | None |
| G9YJS3 | 20-124 | None |
| C0BAN0 | 166-271 | None |
| A0A645E0L8 | 51-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.