DPCstruct | MC6962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 140 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B9LGY6 | 1-129 | MKIASVSSGYRCWSDNHSHNRTTTNHLGKALDINLVHNDSKVTVANLCDNAREVMIRYCDAHYRWSTPNVISLEVGNRVKISTDTAI… |
| A0A844WU11 | 171-302 | KAVIFYLQKENSVYSFRKISSGYRCYDRNLQTNRRTTNHKGKALDIHFNKNGVRTRSCDDMNKLRKDIFNKYLGAKWDWLAGQENMF… |
| A0A226HA94 | 401-551 | None |
| A0A4P6FTB8 | 107-224 | None |
| A0A0T7AP64 | 660-811 | None |
| A0A2H1XW06 | 85-230 | None |
| A0A1C4A5Y3 | 65-196 | None |
| A0A3G2GAB3 | 457-603 | None |
| N9DAN1 | 394-515 | None |
| A0A101C622 | 823-962 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.