DPCstruct | MC6961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 118 ± 16 aa |
| Standard deviation of domain lengths | 15.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A371JWR5 | 3-110 | VIEVAAPVYQPAQGARPAANEEAMCKAWVLDKAQAESFFRLSRPLREGERHDFDWLPCSIKGCLRAQGRDWAFEINAAGTSAWFGGE… |
| A0A1B9LF68 | 74-191 | AVTNANNRDVIKVLSIKKVLEVDNSDYLKDLCNKWKLDKKEIIHFFATAEKDINSAQINSFDIYPCEIKGELLINGINKKYSINLGG… |
| T1CXC6 | 20-125 | None |
| A0A7W3V298 | 144-262 | None |
| A0A1H7HH47 | 1-138 | None |
| A0A1B9MRP8 | 33-118 | None |
| A0A085HF62 | 117-227 | None |
| A0A7Y0VT49 | 1-98 | None |
| A0A1I6JEB1 | 3-137 | None |
| A0A0A0F218 | 126-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.