DPCstruct | MC6960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 87 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381E665 | 231-319 | EGGPNNGKTVDFMFTVNNERSRIGINDYFIKNFNRRKAGIKDTLIDHTNKAHIVPLDFRNLNPENRAMVTDFINREMTKEQKSQIII… |
| A0A1B9L104 | 1-74 | MFTTSNGTEREINAINKFFNNNWDRNIEKLHEHLDKADIVPLDFRKLTSDNQTRLGNYIKTLPEHQRSKIHIMR |
| A0A1B9N0B5 | 154-238 | None |
| A0A1J0E3T3 | 175-268 | None |
| A0A836MPA0 | 83-176 | None |
| A0A847SB71 | 476-562 | None |
| A0A1B9LD66 | 380-466 | None |
| A0A1B9LD72 | 229-313 | None |
| A0A1B9L0V0 | 265-351 | None |
| A0A083ZVM1 | 200-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.