DPCstruct | MC696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0G865 | 6-88 | KKKVERFSDEENNPCLKEHNMSLNCLSQNNYDPDECQKYFQNYKLCKSFWNEVRRYRRINGIRPLLPPPSERESIKAKYFETG |
| A0A6J0C253 | 22-105 | DTTRKRSTKLDSEENNPCLKEHHLSLKCLNENNADHDACTLYFMNYKNCKDFWYQVTRERRKNGIKPYLPPPADRLKIKGEYLK |
| A0A6L2PJ19 | 22-104 | None |
| A0A663E1S7 | 99-185 | None |
| A0A0V0TUA9 | 149-235 | None |
| A0A1W0XBI5 | 6-96 | None |
| A0A3B4XE13 | 21-98 | None |
| A0A7M7HDY5 | 17-101 | None |
| A0A6P3WMC3 | 8-100 | None |
| A0A6P9D216 | 4-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.