DPCstruct | MC6959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0EZC7 | 24-128 | GLPELPPKPAAVKPTVNDRKLQNFLDDLYKGANNPGRVGDGTTADAVRNEFRTLVPTEGKWHLQKAMEVQRGLANWLMNKANTDPAD… |
| A0A1B9KZ37 | 448-548 | DYKDELRAKMEKPDVKDSELKNIMDDLYRPNAKIGSGSTADAVRYEAATGQNVGGKLHLEKAKNYVKALESWLKRNPTASSADRAAA… |
| A0A4R3S7H6 | 485-579 | None |
| A0A6C2YUT0 | 182-286 | None |
| A0A4R3LC53 | 185-280 | None |
| A0A3G8H4H2 | 3-89 | None |
| A0A0X8D552 | 249-354 | None |
| A0A6P1RV01 | 13-114 | None |
| A0A4Q1RTY9 | 16-112 | None |
| A0A514XLH0 | 367-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.