DPCstruct | MC6958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0666 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4E0R8N5 | 1-120 | MAPNDRDHSNVIRISPYHYVHVLNLNTNVTRLVLGPRTFVCMQDEKVVVGPEKMISLAPTQFCVIANPVVKGASGEPLLDPSGQVKL… |
| A0A820LS50 | 1-118 | MSSESLPSQTVPVYHILPFYYIHVLDQNTGVTRLEIGPKTFFKQDNETITLGPEKMIILPPRHYCVVENPVVKNDIGQIQFDENGQV… |
| A0A2V2V3C4 | 18-120 | None |
| A0A6G3Z6Z4 | 6-118 | None |
| A0A1X7ST65 | 1-85 | None |
| A0A2K5QMS6 | 1-115 | None |
| A0A267FM30 | 1-113 | None |
| L8GWT3 | 28-138 | None |
| A0A3A8PTY4 | 1-113 | None |
| A0A818X997 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.