DPCstruct | MC6957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 263 ± 45 aa |
| Standard deviation of domain lengths | 45.04 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.13 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0229- CL0105- CL0379 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482SS97 | 1-184 | MLFSCKPKQWLYTQPLFDVFVRQNLSFAWPTNDGDDLAHEAESVIDDNDEGFVEVEIPEYACSYCGIAEESSVVKCVETGKWFCNGR… |
| A0A820L7K7 | 2-291 | TYNASITQDPSSNFRDPLIFYDPDLTTGNTQATDFAFDDLTLPSQQNHLQLIDANTNFSVDDLDGTNNNNNKTSLIQQRDLPFEDEE… |
| N1RH75 | 1-297 | None |
| A0A7J6QNQ6 | 58-361 | None |
| A0A058Z254 | 28-245 | None |
| A0A183KVZ0 | 3-286 | None |
| A0A0S4KI48 | 37-281 | None |
| A0A1W0X3S6 | 294-615 | None |
| A0A7J6UQ27 | 8-311 | None |
| A0A7J6RSZ8 | 31-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.