DPCstruct | MC6956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 380 ± 56 aa |
| Standard deviation of domain lengths | 56.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6LVK4 | 145-553 | KLTFETSMDELYNQVNKRWRELRQTMEKESSSMEDLKWFEASELSLELQFLFPNWPPERRESVAKSIDEKREKIKRLEKMIVPWAKL… |
| A0A820KHS5 | 24-423 | GTAPHEIRCLDELKQVKALFEMFASKIKRISIDWKQLPISQLIATFPDEQYTDDDFHTIKSLFDESAISSLKQILDYWKYHERISEI… |
| A0A821ASS5 | 2-295 | None |
| A0A816EJH5 | 248-711 | None |
| A0A1X7SL21 | 49-385 | None |
| A0A819YZR5 | 672-1178 | None |
| A0A820R9G2 | 149-563 | None |
| A0A819PXT0 | 149-525 | None |
| A0A6I9PIL9 | 633-1022 | None |
| A0A815M7D5 | 319-729 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.