DPCstruct | MC6955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 116 ± 22 aa |
| Standard deviation of domain lengths | 21.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.37 |
| Pfam Score | 97.67 |
| Assigned Pfam label(s) | PF15260- PF02284- CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820K0A8 | 579-709 | QSLTKTTRPMLMIMTSNARRNMSSHNKETDEEFDQRWKAYFERPNIDGWDIRQGINHMNRLDLIPEPEIISACLQACRRVNDHSLAV… |
| A0A2A2LWL3 | 4-110 | WPAEKFDKHFIDYFNRPEIDGWEVRKALTELHDFDVVPDPKVVEAALRAIRRVNDFSLAVRFLEAIKIKCGPPKAREIVYPWIIKEV… |
| A0A498M8G5 | 4-125 | None |
| A0A6A6G5E0 | 4-111 | None |
| A0A507BJT4 | 75-212 | None |
| K1PVD7 | 28-158 | None |
| A0A6A5DEC5 | 99-202 | None |
| A0A337SBE2 | 20-139 | None |
| A0A368GAX0 | 174-293 | None |
| A0A556U4B8 | 489-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.