DPCstruct | MC6954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 44.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819IXD5 | 35-147 | RDLLHIDSFIYLCFVLFLATTVKCVSPYVQEPSGNCINVLIDINNCGKINNVCPSTYTSCSAGLCSTLSSIKIINGTFIWAASVNGS… |
| A0A814MJD4 | 88-191 | KPKSPIIPVIITINCIYPNVETPMGRCVNILIDSNNCGSVGNVCPNNLSCSAGVCSNVPGIQLDKPITIWSSAINGSADDQMYNVTL… |
| A0A821K2H5 | 88-183 | None |
| A0A819S6D9 | 110-206 | None |
| A0A819G752 | 90-214 | None |
| A0A818Z4L5 | 216-337 | None |
| A0A816F6V8 | 1-117 | None |
| A0A819DKK6 | 146-265 | None |
| A0A819QSB2 | 29-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.