DPCstruct | MC6953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 256 ± 51 aa |
| Standard deviation of domain lengths | 50.60 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2SVJ5 | 33-303 | MAQAFLSLLVRRDIPYPEPVLRMWVRLLIHDTVKARRMATAVVASWLKLNKPKAVKREWVIPNKEPNTSVGARWPIHYGIRNDNRCM… |
| A0A820ILR1 | 1-246 | TWGQQKITISLLCLLLQKFVPLSSSCIETFVDFLVHDNIELRRYATIGIRAFCRLQKPPRLYVEKSLEEIFHNIGKPLPAMMNDEYC… |
| A0A817R8M8 | 99-288 | None |
| A0A3Q0JH44 | 641-888 | None |
| A0A820EK81 | 2-222 | None |
| A0A0D8XTU4 | 140-351 | None |
| A0A0D8Y018 | 27-266 | None |
| A0A820SVQ1 | 318-510 | None |
| A0A819CCM2 | 2-284 | None |
| J9EQC4 | 414-737 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.