DPCstruct | MC6951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 113 ± 7 aa |
| Standard deviation of domain lengths | 7.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482VZF0 | 319-423 | GFIKEAPLIWDSLRSIICVYKPTNVTCERVRKTVITAICTGLNEMRCRPPIDYVSIEGNPSDKLTVTVKPNLADHPLVVGPRYQEGD… |
| A0A820I886 | 6-134 | AELLYDKLSGIACLFKPADMKMQHFFTIIQERLASAFNQMSCRPPMNRVDIIRDSQTGKEMVVSSVDLSDTIQALGPRYQLEDFDIQ… |
| R7U3H7 | 145-247 | None |
| A0A6P4FGG9 | 3-121 | None |
| A0A4Y2S3Y8 | 4-110 | None |
| A0A6J0TND3 | 2-110 | None |
| A0A0B1THP0 | 112-230 | None |
| A0A7R9KF30 | 6-110 | None |
| A0A6I9JQE3 | 24-123 | None |
| A0A5J5CAE4 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.