DPCstruct | MC6950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 102 ± 27 aa |
| Standard deviation of domain lengths | 27.04 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 34.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820HN98 | 5-69 | LTKEECRKLFRQFDNGNGILSLAEIDRAIVYWHPEFGTNRQAMIRAFKAADTNGTGFIEFKEFRR |
| A0A0V0R6Q2 | 10-118 | WAELAQKLPSKKNPEDYKKRTELFNLFDPNGNGYLSLAEVDKGIRDILRCDTLFDVKPVIMRAFQAAKNSVKTKSKYGDDYIERCEF… |
| A0A812Q0Z4 | 5-121 | None |
| A0A7S1FF38 | 8-127 | None |
| A0A820K2D3 | 1-65 | None |
| A0A7S3ZU34 | 24-152 | None |
| A0A397SCJ7 | 114-205 | None |
| A0A814U007 | 99-162 | None |
| A0A7S0HS49 | 1-113 | None |
| A0A7S3SY00 | 118-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.