DPCstruct | MC695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 155 ± 20 aa |
| Standard deviation of domain lengths | 20.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 16.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3ZLC3 | 6-145 | TNLNSWQVAAGWLLITALTIFGFVYFWYYLYLLLDGLFSSADAITLNKGAFYCFGGAMLGCILLYFGINKLRGKAVTKAQNKTASYG… |
| A0A1B2F377 | 3-154 | TSTPPALTALSFRLRAGLTFLICAGVGIFAVYWLIAHVLPIYGQLWRRASAIEVPYLAFGLLMAPPIMLSCSLAAAYAFWTGKKFNP… |
| A0A380QBP3 | 20-190 | None |
| A0A5P8YKI2 | 6-143 | None |
| A0A1H0WE83 | 291-464 | None |
| A0A2T4I3I2 | 8-137 | None |
| A0A2T5GL89 | 2-155 | None |
| A0A318D4Z1 | 1-152 | None |
| A0A2A5LYB6 | 7-153 | None |
| A0A0B6FR85 | 5-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.