DPCstruct | MC6949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838LJV1 | 29-95 | AEGEPLVVGNEFAEVRVAKVQTRNGVRLLVESPKSGQWITLDPLELEALTWQNVATFSAMVGNPFAP |
| A0A0C2G712 | 1-62 | MVVANEFVDVVVRKVDTRNGVRLEIWSPRHNTCVRFDAVALDCLSYQEPEFITSLLARKPGP |
| A0A7U1CKA2 | 12-77 | None |
| D5WVJ5 | 19-89 | None |
| A0A5Q0SIG9 | 4-64 | None |
| A0A1C5K582 | 3-73 | None |
| A0A1E4I526 | 8-73 | None |
| A0A522TYF9 | 1-61 | None |
| A0A1V2A8X8 | 2-77 | None |
| A0A2R6XZF2 | 20-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.