DPCstruct | MC6948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 164 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 61.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H2S6H0 | 191-331 | EAVETAIWLTEVAPHIGKAGKRFRTHLADANHDANPELMRLALKLATGAGKTTVMAMLIAWQTINAVRYESSKRFSRGFLIVAPGLT… |
| A0A855UAH7 | 1-174 | MEAVETLIWLTEVAPKLPKDSFGTGIWAHLKSANLEANPELMRVALKLATGTGKTTVIAMIIAWQTINAVRRPANSNFSRGFLIITP… |
| A0A2V6X7Y7 | 112-265 | None |
| A0A0E3B079 | 130-301 | None |
| A0A1F7LSD9 | 131-297 | None |
| A0A518HY77 | 129-295 | None |
| A0A3L7Q9E2 | 130-296 | None |
| A0A178M8S0 | 131-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.