DPCstruct | MC6947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 5.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0P9Q0 | 14-80 | GFSVETDFAIVESDDAVAINGAFIVYNSVSGALYYNANGSESGFGDGAQFAVLNNDVSLEANNFKIR |
| A0A6P0PGP1 | 279-337 | VFATVTSDSDAATEDAVIVYNTNNGNLFYNQNGNDAGLGSGGVFVTLDNAPVVDADNFS |
| A0A076H880 | 326-390 | None |
| A0A7G8D078 | 490-557 | None |
| A0A354WJJ4 | 380-448 | None |
| A0A4P7ZSY1 | 203-272 | None |
| A0A2T1D2X7 | 262-317 | None |
| A0A7G8FKP9 | 286-358 | None |
| A0A6J7ZLG8 | 876-935 | None |
| A0A845Z9M7 | 517-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.