DPCstruct | MC6943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537RWP8 | 2-100 | TYEEFWPRYLAGHADRRTRALHYLATAGALACIPAAAITADWGWLIAAPVVGYGPAWLAHAAFERNRPETFSHPIWSLLSDFRMLGL… |
| A0A538BA68 | 9-117 | GVNAPDPNTYEEFWPYYVSQHLHPATRAIHVGATSAAVVCGAAGFVFFNPLLVAAAPVIGYGPAFASHFLIEKNKPASFGHPVWSFR… |
| A0A6M8HLG2 | 3-112 | None |
| A0A504X544 | 1-111 | None |
| A0A1J5QKN5 | 23-122 | None |
| A0A2M7G1T2 | 5-106 | None |
| A0A534C7K1 | 38-145 | None |
| A0A2H0QKD9 | 152-254 | None |
| A0A5C7NK69 | 1-115 | None |
| A0A357IXI2 | 16-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.