DPCstruct | MC6941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 184 ± 42 aa |
| Standard deviation of domain lengths | 42.10 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.99 |
| Pfam Score | 98.81 |
| Assigned Pfam label(s) | CL0020- CL0170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9C584 | 3-150 | PDRALNDEFDHWQKDPLSVISLILILDQFPRNMYRGTARSFAYDDKARLVAQAAIDLGIDGKVHPLEATFIYLPFEHSEDPRDQVTS… |
| A0A537R8Z6 | 150-321 | AKSLLDFWFGPEADPDREQPRPIWFKSTDEFDAALRREFLADYEAAAGGSLRSWEASPEGALALLLLLDQVPRNIFRGSPRAYASDA… |
| A0A371XFN9 | 18-199 | None |
| A0A7S4PEB8 | 363-528 | None |
| A0A7J7INC6 | 7-214 | None |
| A0A545UYB6 | 55-331 | None |
| A0A3D8T9D3 | 8-287 | None |
| A0A433QHF4 | 28-195 | None |
| A0A7W4MYN7 | 1-102 | None |
| A0A226EW66 | 4-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.