DPCstruct | MC6940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 8.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13569 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M1YVH2 | 290-396 | AQRMEQAMVTGRRWKTEEWEMLIAKHPLMTHIAKTILWWVCFPDREKSVEVFRLTEERDYADVHDNSLNLQGGAYVGIVHPLLLLSE… |
| A0A850CBJ7 | 126-228 | IARLEAAMTATRSWSLEEFRRFFVDHALTRHLARRLVWTAETGGVFTGFRIAEDGSFSDAEDETIELPADAAIRVAHPVHLGDQVAA… |
| A0A4Z0P800 | 44-148 | None |
| A0A7X7RD79 | 73-175 | None |
| A0A1L9ATZ8 | 492-599 | None |
| M6R9Z8 | 689-798 | None |
| M3GMT2 | 323-424 | None |
| Q8F857 | 149-258 | None |
| A0A1X1NJ68 | 451-569 | None |
| A0A366DVY8 | 5-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.