DPCstruct | MC694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 163 |
|---|---|
| Mean domain length (aa) | 143 ± 26 aa |
| Standard deviation of domain lengths | 26.43 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.29 |
| Pfam Score | 41.29 |
| Assigned Pfam label(s) | CL0023- CL0270- CL0137- PF07905- CL0365 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3YGV9 | 1-113 | MKLQEILDIVDGRELYIDSPHVYEIDFQDAFGTDLMSDALCHLRDADETELLITGLANMQIFHTANTLDLAAILIVRGKTIDEHMIQ… |
| A0A1B2F2W3 | 3-149 | QRVRDLIAIPELRSRLLSGAQGLDHKVRWAHVCELPDPTEWLGEGDVLMTTGLGIPRVPAEQHTYVTRLAQAGIAGMMIGEHMQAPQ… |
| A0A7Y5W1R2 | 72-209 | None |
| U1QYJ0 | 140-257 | None |
| A0A534MUK7 | 1-122 | None |
| A0A396R0J6 | 1-159 | None |
| A0A6L3ESL7 | 9-168 | None |
| A0A1T3NRE2 | 24-176 | None |
| A0A7X8K8M7 | 2-224 | None |
| A0A6G3V2F5 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.