DPCstruct | MC6938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 172 ± 15 aa |
| Standard deviation of domain lengths | 14.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1Q208 | 103-257 | WQAEIWQDILKLHYRLITERDIEEKYSNLYAISQLTVSTSIVLSRFKKLNERKPWKEQIKPFNFFLVSFQVIIEDDKAVKPLAPFTK… |
| A0A2V9GAS7 | 257-421 | EFWRKVLQNEGIAFKSGEPDWLDRPAMMRIPVSSPAVLGRLKDFCRPYDFVLAPVIRDGDLALDGEADKPILVTRFTKNSQELSTVE… |
| A0A4Q3Y9G5 | 401-576 | None |
| A0A3D5ZTR0 | 139-327 | None |
| A0A525KBF6 | 341-516 | None |
| A0A2N5KGF8 | 3-152 | None |
| A0A0E3LTZ5 | 327-483 | None |
| A0A840Q7E0 | 329-521 | None |
| A0A6I6S4J8 | 633-791 | None |
| A0A2E4S4L1 | 491-683 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.