DPCstruct | MC6937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 13.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13876 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A526PSI5 | 10-104 | GDAAAAAVAKTDKRVTLASMVEKIAAEAYINDAIEPTLTICLMKLQNGFVLVGKSAPADPANFNQELGEKFAREDCIRQLWPLEGYL… |
| A0A510XAI4 | 203-293 | QQIQAKGLNAPRVTPDALDAKIIGEDYHVFPGTTVTVCLLRLENGFTVTGESACASPENFDPELGREIARRNAREKIWMLEGYLLRE… |
| A0A1X7AE48 | 2-85 | None |
| A0A2A4HYF7 | 5-127 | None |
| R5M2J6 | 73-161 | None |
| A0A7I8I4P5 | 78-157 | None |
| A0A136I231 | 97-191 | None |
| A0A656HAM4 | 6-105 | None |
| A0A855RXP5 | 6-108 | None |
| A0A6N8DLC1 | 14-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.