DPCstruct | MC6936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.79 |
| Pfam Score | 96.51 |
| Assigned Pfam label(s) | CL0023- PF01655- CL0644- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6FHU0 | 362-468 | GKPQFNRQDHHVKKRTPTSWRRPRGQLSKQRRGVKGKGDTVEAGFRTPTAVRGRHPSGFEEVRVENVDDLDGVDGDREAVRIGATVG… |
| A0A5E4JHW0 | 7-122 | HAVFRVPNYGAKNRKGVKPRWRKQRGIDSKLRIDLSGYGQTPKVGYKNPEAVRFVRKDGLKTQLVHNQKELEALFTQSKKYSVVLSH… |
| A0A6A4K611 | 26-145 | None |
| A0A643BMR7 | 6-88 | None |
| A0A497SXS3 | 2-114 | None |
| A0A7T5R9C7 | 1-110 | None |
| K1Q227 | 421-522 | None |
| A0A485NEN0 | 1-61 | None |
| A0A0E0M303 | 1-104 | None |
| A0A0B3AE06 | 2-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.