DPCstruct | MC6934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 8.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N9RB22 | 2-85 | ELNAEKLLEKVFLKMMKAIESKPIIPIEHQLWDLDDIAQYFDYSADYVKRYIITNKHFPPSRDLPTKDDHTVQRWRAKDVIDYA |
| A0A0J5P4X7 | 15-101 | LLKIDSRIGSIEAQFEELTQTLNRRNRPIWTEQQIADYLGLSYGYVTTKIVTLEDFPKPIDYGSTGIHRRHRRYFSAEIIAYFKQQE |
| A0A8B2U271 | 8-92 | None |
| A0A5E4ZE24 | 25-112 | None |
| A0A7X3G6T1 | 83-168 | None |
| A0A2X4G3W4 | 11-90 | None |
| A0A5E4YZ19 | 82-172 | None |
| A0A3B1B8R2 | 2-78 | None |
| A0A4R1IWG9 | 81-166 | None |
| A0A074JVM5 | 56-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.