DPCstruct | MC6931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2183 |
|---|---|
| Mean domain length (aa) | 151 ± 22 aa |
| Standard deviation of domain lengths | 21.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.11 |
| Pfam Score | 98.37 |
| Assigned Pfam label(s) | PF07833- CL0125- CL0022- PF08379- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380IJM7 | 5-145 | HKEYKQFVDSFVKENITNKNITSDYEKAKVIHDHLVNNYTYATEELATTRETASGISIHAPEALYKDKRGVCQAFAVMFKDMAATAG… |
| A0A7Z7GGA1 | 30-172 | TGTGNGATIQWDDNFERFCCELAEGCSSDAERVTVFRNWIIQNISYDEESEVLFYQTFHVGKVMQSKKGVCFDYACLFAAMCRSQGI… |
| A0A2N1R6L5 | 34-202 | None |
| A0A843DZA1 | 117-292 | None |
| A0A497NW92 | 7-137 | None |
| A0A7J4HYM1 | 33-156 | None |
| A0A1Q6KAR7 | 72-217 | None |
| A0A416I7S8 | 58-206 | None |
| A0A1C6KJ83 | 201-338 | None |
| A0A0G4HMU1 | 4-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.