DPCstruct | MC6928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 121 ± 8 aa |
| Standard deviation of domain lengths | 7.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A374ED42 | 128-248 | PEIDEDKVLLTLSNFDKYYYHSAYCKLSSKQEPVSFRAYPHIGMLQDSFTISGDGSLIKLSYFPHPKNIQFYCESTAKMPLFVENIG… |
| A0A6L8TK41 | 1-119 | MQSHLKKIGARIYLYEKDALVQKVAYVYEDGTESEPLPRFIHFGMFTDSVLFGEECQIRFFVYPFSLRLYDTDVNSLEFFNGSDRTV… |
| R6SXY7 | 144-259 | None |
| A0A174GC57 | 178-301 | None |
| A0A416IAL5 | 151-277 | None |
| D4C9N5 | 101-226 | None |
| A0A1H4FEQ8 | 242-369 | None |
| A0A7X7ZF47 | 109-226 | None |
| A0A1C5L2Y9 | 16-143 | None |
| A0A1G4Q5F2 | 287-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.