DPCstruct | MC6927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C0VJR7 | 1-74 | MLKQIEGKGEIYQGDVVWEIQAEFGGEFVYENENFNLAISPAVLKEFRKITADTVVWSRGERMWRKRDTSDEPG |
| A0A329MLU4 | 1-67 | MVKEIKFRGILSQSDAIAYVRANFGEAFVFVNENGNASLEKEVKKAFRKLHGGKVAWDRDGFFWGWT |
| A0A229NYI9 | 15-88 | None |
| A0A7T3RHE9 | 171-252 | None |
| A0A175JC54 | 16-93 | None |
| A0A5F0D9G5 | 3-81 | None |
| A0A496PHB7 | 47-125 | None |
| K2FGT3 | 1-76 | None |
| A0A6H9UVQ8 | 1-88 | None |
| A0A3S0K7P1 | 6-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.