DPCstruct | MC6926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 132 ± 15 aa |
| Standard deviation of domain lengths | 15.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19728 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536BV14 | 5-132 | IVLARRVHLAATWVFLAAILLQVFLVGLVLFAGGNIDNHRQFGYSIIFVALAVLLTALWARVPRRDGWMAAAVLGLYIVQTSFPQFK… |
| A0A329MLI7 | 4-115 | GRIAYRVLAWTFLCCIVIQVFIAGMATFGDPSKWQSHASFVKIFAMAPLVMFLLTFIGGIKGRERLLSLALFLLVVMQFLTIQVFSS… |
| A0A1R1ERK1 | 8-128 | None |
| A0A535JE89 | 6-133 | None |
| A0A3A5JMG9 | 2-121 | None |
| A0A1N6VXF1 | 59-177 | None |
| A0A535W6A0 | 12-168 | None |
| A0A7X0VYH2 | 4-126 | None |
| A0A1R1F3Y1 | 37-165 | None |
| A0A1H4VMV6 | 13-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.