DPCstruct | MC6924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5BL88 | 2-71 | PKLTLKDGKIALFSRYEDRETAKSITGREWSPLYKCWLYPLRAETLNELTIAFPGIEVDPKVSEAVLGVA |
| A0A329MFJ3 | 1-78 | MRDAVVISKYSEQYVSVSFPYRADYVDRIRSVPGRRWNPGGKTWLIPYTLANVAALTSLFRGAAELAGELEEECGFVR |
| A0A7V4YP31 | 1-73 | None |
| A0A1V4GGJ2 | 37-103 | None |
| A0A1D2RC45 | 1-84 | None |
| A0A0C2USZ2 | 1-75 | None |
| C6XEQ6 | 1-63 | None |
| A0A1F9VIB6 | 5-93 | None |
| A0A287HHA5 | 64-133 | None |
| A0A369QC69 | 5-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.