DPCstruct | MC6922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 16.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q8X5U2 | 140-268 | LKVEDVASLQVVGGLPGTKGSPLYQSTNETGKTIIAKIVSWINTSKPTGVQEEYGKHGYPMVIELKMNDGKFMYVETGYNCVIKSNA… |
| A0A329LQH3 | 1-114 | MQVVRNTPGEQEQMYKNTDGPGKNRITKVVEWINNSKLVSGSAEFGKYPMLIKIQMNDGTLITVSQAYKWVHGTMPDGSGFSHATPI… |
| A0A494Y2C7 | 329-450 | None |
| A0A0L6JJK2 | 35-194 | None |
| A0A0V0PSF7 | 235-367 | None |
| A0A418MM61 | 32-163 | None |
| A0A0P9EIF5 | 94-226 | None |
| A0A5C8M8W9 | 148-280 | None |
| A0A1H4JID8 | 69-204 | None |
| A0A2V4VUH8 | 33-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.