DPCstruct | MC692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Standard deviation of domain lengths | 10.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A7SX31 | 7-81 | IDHEDLIDFGYTWKGMVGISRSLANAFYERNYAVYVLYDDNTESLVDEEYKLDLENVLYGIEKEDLAKYIFSWLG |
| A0A6G7KCR4 | 11-90 | MPDPNISISDRNSYGYLDDEMLPLSKGRATELFEKDLPVFLLYEDDSEAIAFDLKDINNHNGIFGIELINWVDQQNYLET |
| A0A1C0BKW3 | 406-512 | None |
| N9FDG8 | 38-119 | None |
| A0A4R1R2T0 | 139-237 | None |
| R9KP55 | 95-180 | None |
| A0A6N7WLF5 | 221-300 | None |
| A0A1C6IBN1 | 74-141 | None |
| K1UDP1 | 253-334 | None |
| A0A3A8YAP1 | 1026-1101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.