DPCstruct | MC6919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 38.26 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF01826- PF00014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7I3N0 | 10-111 | IGNCPPDKPRHYCLIPPCLNAKCPAYPDAKCVDNYCGGCNADFYVGDTKVNCGQCPPYKPRHYCLIPPCNNAKCPAYPDAKCVDNYC… |
| A0A819HRT4 | 20-128 | RSAAIGGCPRGKPMVYCLIDPCTTSTCPGDKSATCTANYCGGCNAIWTSANGKPAKCSTCPSGHGVVQCFVDPCKDKTCPKYPDAKC… |
| A0A814Y458 | 301-418 | None |
| A0A6J8DUJ6 | 131-247 | None |
| A0A818GTI3 | 2-106 | None |
| A0A814UX96 | 110-201 | None |
| A0A820K0K8 | 1-93 | None |
| A0A6P4Y6U5 | 16-120 | None |
| A0A3Q1F499 | 47-163 | None |
| A0A1X7SSB1 | 5-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.