DPCstruct | MC6918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 131 |
|---|---|
| Mean domain length (aa) | 137 ± 24 aa |
| Standard deviation of domain lengths | 24.15 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 96.07 |
| Assigned Pfam label(s) | PF02580- CL0475- CL0617- PF08915 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819G3T2 | 8-142 | VTEASVQVNNEIVGAINNGLMILLGIEDADTNEDIEWLSNKIINLRIFNDENEVMNKSLLDVNGDILLISQFTLHASTKKGNRPSYI… |
| A0DLP9 | 8-145 | CLSGSVSVGDQLVSQIGKGLVVLLGIHERDTKEVAKKLAHKLSKIRLWEKENKAWNGSCVDFNYEILIVSQFTLYAYMKGNKPDFHY… |
| A0A2J8ABY6 | 1-124 | None |
| A0A6P8HB78 | 4-109 | None |
| A0A2G8LR42 | 50-200 | None |
| A0A504WWJ7 | 2-177 | None |
| A0A6P8CYI6 | 73-190 | None |
| A0A7R8X2Q6 | 9-134 | None |
| A0A6G1LS80 | 1-108 | None |
| H3ACJ5 | 38-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.