DPCstruct | MC6917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 220 ± 27 aa |
| Standard deviation of domain lengths | 26.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 22.87 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF08439- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9MWP2 | 1-239 | MERSEIKQEYKWNLSDIYENYSAWEKDFEKVSELKKELAGFKGQFGNEGKLLEFFQKQEEMDKISYKLYRYPQLARDLNSSDKEAVE… |
| A0A1Y0VSZ8 | 6-246 | LTRAEVPEALTWNVTDIFTTEADFKKAIQQVEKQIVEIQANSKHMTESATQLLTLTELLYESEELLMKVYGYAARVNDGDTADPHGN… |
| A0A090YKK0 | 5-243 | None |
| A0A535EQJ8 | 14-193 | None |
| T2RDX8 | 62-236 | None |
| A0A7C4C7P6 | 28-266 | None |
| A0A090R1C9 | 5-206 | None |
| A0A4Q3VI56 | 12-248 | None |
| D0GJZ1 | 281-541 | None |
| R5FX09 | 4-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.