DPCstruct | MC6916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 159 ± 15 aa |
| Standard deviation of domain lengths | 15.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662F6Q0 | 9-160 | REIPDPQVRDAADQFDNARLLLAAQPPGSGLLLPLLNNAIIAIELYLKSLGSIVVCTPNPGFPECSIVTAEAEVKGHGLIDILESIP… |
| A0A811SUN1 | 1-157 | MRQEIPDPQVKDAAEQYFNAWKELYKLPPGSGVLLPLMNTATVAIELYLKCLCSEKIFTPVDFEEGIFIVTAKPQKHGHDFIEIFKK… |
| A0A3R9SEV3 | 64-228 | None |
| A0A7X3MLI2 | 10-140 | None |
| A0A3D1VUV9 | 3-149 | None |
| A0A517YNI8 | 1-190 | None |
| A0A257JPB9 | 35-183 | None |
| T0H1N6 | 18-166 | None |
| A0A533B4H6 | 11-205 | None |
| A0A7X2CDN2 | 2-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.