DPCstruct | MC6915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 12.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 23.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20074 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179IS45 | 59-189 | VPARMRIERTPPKLSIDQSGAWAALGRLGALEAARRAAEAGREGALEGIARRAEEGRRLARIEAGTGGGRAIADIARDRAFPPPPPP… |
| G2PW01 | 11-117 | EFVKVKLSQEHVKVKIDQDRCWEEVNLGSTDYLVRSSAQRGYEQVLRYIEKTAENGNRLARIEDGGEPIIDICIEEAFPTYDYNVDI… |
| C9RAZ2 | 1-89 | None |
| A0A7V6GBD5 | 8-137 | None |
| A0A7G6E8K4 | 2-112 | None |
| A0A101F5V1 | 74-194 | None |
| C6J2J3 | 10-132 | None |
| B0TH42 | 13-120 | None |
| A0A4S4BZS4 | 19-151 | None |
| A0A832JTZ5 | 2-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.