DPCstruct | MC6913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 173 ± 18 aa |
| Standard deviation of domain lengths | 18.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0V099 | 2-150 | GILGGGMWALVRPAYIGVVEGGGLRVDQAESPVNAEFAGFGSFALLTTLAGVVVAVVALVAAKRGKVRGSVAWLIWAGIVSALAAVA… |
| A0A101NBC5 | 2-178 | KTELLEGAVIMVAVALAGALLGVLWWWLAPHVPLVGDVDAQGNWAVYLKDTEGEQAVGADGTLTLLALAFGFVSALAVFLWRRRGGV… |
| A0A0F6TE50 | 43-204 | None |
| C6WDB3 | 267-422 | None |
| A0A368T3T9 | 2-183 | None |
| A0A7J9VLR7 | 29-195 | None |
| A0A1V2IB86 | 24-222 | None |
| A0A0Q8VKV5 | 12-176 | None |
| A0A1Q7WBP1 | 56-263 | None |
| A0A6I0F9V2 | 5-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.