DPCstruct | MC6912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 183 ± 18 aa |
| Standard deviation of domain lengths | 17.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4MCS3 | 21-194 | FFFAVVIALLVKAFIGRIGIDYLLDAGVQKRITGWAVDFLIVATIMAIQLVIIWEYIVPILLIGLVSGIFTTLVVFYLGRRTWGYSL… |
| A0A328JC19 | 8-175 | EIEYMNDFLLQRIGGGVFHFMVAASIAGISFSVIQEYIWPVIILTSVGGLFIAGYTIWFGKRIYEKAPLEHIVTFFGMHTGTLSTGM… |
| A0A7Z0EKT9 | 7-189 | None |
| A0A448VRZ0 | 156-361 | None |
| A0A1V0DIB8 | 94-272 | None |
| A0A061P5J0 | 35-237 | None |
| A0A523SYG4 | 83-269 | None |
| A0A1G6HTG2 | 42-215 | None |
| A0A3E0KA38 | 92-267 | None |
| A0A644X248 | 27-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.