DPCstruct | MC6911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 171 ± 17 aa |
| Standard deviation of domain lengths | 16.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14846 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9W3M8 | 11-194 | EVLKLDEHFKRILTYVRSYISNLRSIEEAHLCRIWLNKLHSSITQRNLRNEYLLELSRQLKTGTLEGIFKIEPPNDLLPPLSSSCHA… |
| A0A7N8WZY3 | 9-190 | QRLDTEFDHFLLDMKPYVLKHPNRTERQRCAIWIKKLCDPVTCGSGLIDRRNRNLYARLLLHMLKRGVLEAPFTSKPEPGNLKTLPT… |
| A0A5J4YE19 | 22-182 | None |
| A0A401SXY5 | 73-248 | None |
| I7MI89 | 58-271 | None |
| V6LMJ8 | 1-195 | None |
| A0A5B8MIR0 | 36-209 | None |
| A0A7E4RYG9 | 11-179 | None |
| A0A444UNP3 | 251-402 | None |
| A0A6S7GZJ4 | 18-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.