DPCstruct | MC6910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 157 ± 16 aa |
| Standard deviation of domain lengths | 15.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.09 |
| Pfam Score | 66.36 |
| Assigned Pfam label(s) | PF09744- PF11461 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7Z5K6 | 17-214 | MESTLEKPVASLTVDDVYDVAKAIGAEVEKLIDSFGKEAVVGLVPKIVRVLELLESFAARSQSCTSKEEELLKAYETFQAQQQQQQQ… |
| A0A7N8WSB4 | 1-155 | METGVVSALDRPAAELTVMDVYDIAAVLGQEFERIIDRFGCESLVGVVPKVVRVLELLEALVSRGATGQEAEELRRELDRLRQERSD… |
| F6RVD7 | 82-236 | None |
| A0A151NT33 | 40-183 | None |
| A0A3Q2Y6A0 | 8-172 | None |
| A0A2G9R867 | 3-160 | None |
| G3NZX5 | 1-135 | None |
| A0A3Q3F303 | 1-145 | None |
| A0A1A6GRI8 | 6-155 | None |
| H2LNT6 | 12-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.