DPCstruct | MC691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 16 aa |
| Standard deviation of domain lengths | 16.29 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1Q4S1 | 60-149 | VSIGSDGQWWDDYSFVKHPFICYRETVRKQVVRLMMKLEDSSVDLNDPAVKADLLKQFQDRLKDNGLSDVTLKWREQPDGKVFHKNQ… |
| A0A315WFG6 | 81-189 | ILQLLEENRAQQQGEVCVFATFDALGKWEDWRCDVKKTFICSSTAVFQKVVSVKLEKTSGLDLNSAAVMEELLTQLLLKLKQEGLDA… |
| A0A1A8BZ10 | 76-181 | None |
| A0A4Z2EQQ3 | 1-87 | None |
| A0A6P8SZK9 | 30-176 | None |
| A0A1A8BAP8 | 2-112 | None |
| A0A6I9NG97 | 57-171 | None |
| A0A7J5X7F9 | 13-128 | None |
| A0A087XKT2 | 172-269 | None |
| A0A4Z2HM17 | 123-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.