DPCstruct | MC6909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06904 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0TSW2 | 139-217 | PDKKRVTLTPAATMRCTMATEIANWVRSDVVPEVAKLGSAITALDNFDSYECRGRNGKTGAPLSEHGRANAIDVHGFKL |
| T1XF76 | 1-87 | MRLGTAPSLSCPMALSFFMWERHALQPAARQRFGQPVVAIEHLGSYACRNVNRGEGAVPGASRSRHATADALDVASLTLAGGYDMCR |
| A0A8A7CLX2 | 147-224 | None |
| A0A0S3PVE9 | 179-257 | None |
| A0A2S9JXX7 | 156-239 | None |
| A0A1E3WA48 | 28-103 | None |
| A0A1E3VL38 | 91-169 | None |
| A0A840AXT4 | 36-110 | None |
| A0A353IMG8 | 46-123 | None |
| Q3SV06 | 32-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.