DPCstruct | MC6908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 9.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U0T3Q1 | 1-90 | MKYYTVKNWKEFQHYTKRNPPWIKLHRAMMDDYHFCSLPDAAKGHLILLWLCASQNGGLVPADLPFLERKLSITDLDLQIFVQRGFL… |
| A0A2E0HLZ3 | 1-94 | MEFFQVCNWRELQHYKDRAPPWIKLYNHLLENYEFSLLADQEKFHLLGIYLLASRQNNKLPMDPGWIKKKIDADSEVNLHKLIELGF… |
| A0A441D3D7 | 6-123 | None |
| A0A6L9PW32 | 2-103 | None |
| A0A364NVS2 | 2-98 | None |
| A0A7X6I9Z3 | 16-131 | None |
| A0A1E7IC66 | 2-89 | None |
| A0A6M3JQ34 | 1-100 | None |
| A0A6H1ZZ28 | 1-110 | None |
| A0A7W1DAY2 | 5-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.