DPCstruct | MC6906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 122 ± 20 aa |
| Standard deviation of domain lengths | 20.15 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0I7I8 | 34-168 | VNNPFYAKECSACHFAYQPGLMPARSWQKIIANLDDHFGENAELKAEDQKVLTDYLVNNAAEYSKHKRSVKIMRSLAKDKTPLRITE… |
| A0A2E0HBU5 | 132-256 | NYQAECGSCHLAYPPRLLPAVSWATLMSGLADHFGENAELAPVTTANIARYLVTHSAPDRSRFARYAKGEVPLRISGLPYFRHEHHE… |
| A0A2N6FX88 | 2-78 | None |
| A0A645G8R0 | 2-97 | None |
| A0A6L9KTN1 | 163-265 | None |
| A0A3B9P1C8 | 23-131 | None |
| A0A3Q9BUL8 | 4-124 | None |
| A0A1Q8QUA0 | 4-127 | None |
| A0A1B8TDJ4 | 40-169 | None |
| A0A1J5IU56 | 49-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.